• Quality Large Size T441 Thrust Tapered Roller Bearing 111.76*223.52*55.88mm Brass Cage wholesale
    ...111.76*223.52*55.88mm Brass Cage Bearing Specification : FSK BEARING Model Number T441 Part Name Thrust Tapered Roller Bearing Application Tower Crane/Rolling Mill/Oil Drilling Material Gcr15 Chrome steel Cage Brass Cage Row Single Row Brand TIMKEN / NSK / NTN / FSKG / KBE / OEM Precision Rating ABEC-3 / ABEC-5 Dimensions(mm)(d*D*b) 111.76... more
    Brand Name:TIMKEN / NSK / NTN / FSKG / KBE / OEM
    Model Number:T441
    Place of Origin:CHINA

    Large Size T441 Thrust Tapered Roller Bearing 111.76*223.52*55.88mm Brass Cage

  • Quality Butylene Glycol Numero Cas 107-88-0 Cas Number 1 3 Butanediol Comestic Grade wholesale
    Comestic grade 1 3 Butanediol CAS 107-88-0 1,3-Butylene Glycol is a natural diol, very pure, clear and odourless liquid. It is a common humectant used in cosmetic as moisturizer for the skin, solvent, fragrance enhancer. Our bio-Butylene Glycol is COSMOS ... more
    Brand Name:ChemFine
    Model Number:Cosmetic grade
    Place of Origin:Jiangsu, China

    Butylene Glycol Numero Cas 107-88-0 Cas Number 1 3 Butanediol Comestic Grade

  • Quality Boiling Point 295.6°C At 760 MmHg 2 Phenylacetamide Cas Number 103-81-1 wholesale
    ... the chemical formula C8H9NO and molecular weight of 135.16 g/mol. It has a white crystalline appearance and a density of 1.1 g/cm3. Cas Number: 103-81-1 Storage: It is recommended to store this product in a cool, dry place to maintain its stability and more
    Brand Name:BOSI
    Model Number:103-81-1
    Place of Origin:China

    Boiling Point 295.6°C At 760 MmHg 2 Phenylacetamide Cas Number 103-81-1

  • Quality Cas No 103-83-3 Cas Number 103-83-3 Msds BDMA N N-Dimethylbenzylamine Pka 99 wholesale
    N,N-dimethylbenzylamine of Benzylamine series and related products series Appearance: Colorless to light yellow liquid Purification: ≥99% We are a professional company which integrates R & D, production and trade of pharmaceutical intermediates and fine ... more
    Brand Name:GQ
    Place of Origin:JiangSu
    Minimum Order Quantity:10g

    Cas No 103-83-3 Cas Number 103-83-3 Msds BDMA N N-Dimethylbenzylamine Pka 99

  • Quality VMCC CAS Number 9005 09 8 Vinyl Acetate Terpolymer For Metal Ink wholesale
    CAS NUMBER 9005-09-8 Carboxyl-Modified Vinyl Chloride/Vinyl Acetate Terpolymer VMCC Used For Metal Ink VMCC is white powder,ketone soluble with colorless,transparent solution,and because of the carboxyl functional group,it has excellent adhesion on metal,... more
    Brand Name:DR
    Model Number:VMCC
    Place of Origin:Made in China

    VMCC CAS Number 9005 09 8 Vinyl Acetate Terpolymer For Metal Ink

  • Quality Liquid Injection Epoxy Resin Hardener Cas Number 1675 54 3 Electrical Insulation wholesale
    Liquid Epoxy Resin And Hardener Cas Number 1675 54 3 Electrical Insulation with Casting Process Product TDS: The Technical Data Sheet (TDS) for injection epoxy resin may vary depending on the specific product and manufacturer. However, here are some ... more
    Brand Name:JT-RESIN
    Model Number:JT8881
    Place of Origin:China

    Liquid Injection Epoxy Resin Hardener Cas Number 1675 54 3 Electrical Insulation

  • Quality 2 Years Shelf Life BMK 2503-44-8 CAS Number Powder Oil in Stock wholesale
    2 Years Shelf Life BMK 2503-44-8 CAS Number Powder Oil in Stock *, *::before, *::after {box-sizing: border-box; } * {margin: 0; } html, body {height: 100%; } body {line-height: 1.5; -webkit-font-smoothing: antialiased; } img, picture, video, canvas, svg {... more
    Brand Name:Chuyan
    Model Number:2503-44-8
    Place of Origin:Wuhan

    2 Years Shelf Life BMK 2503-44-8 CAS Number Powder Oil in Stock

  • Quality Electrical Insulation Casting Epoxy Resin And Hardener Cas Number 1675 54 3 wholesale
    ... transformer and molds Overview Essential details CAS No.: 1675-54-3 Other Names: Epoxy Resin MF: C21H24O4 EINECS No.: 216-823-5 Place of Origin: Shanghai, China Type: Modified BPA Epoxy Resin Brand Name: WENYOU Model Number: LE-9214F Purity: Epoxy Resin ... more
    Brand Name:WENYOU
    Model Number:9216F
    Place of Origin:CHINA

    Electrical Insulation Casting Epoxy Resin And Hardener Cas Number 1675 54 3

  • Quality 25% Astragaloside IV , Health Care Astragalus Iv CAS Number 84687-43-4 wholesale
    25% Astragaloside IV Product Astragaloside IV CAS 84687-43-4 MF C41H68O14 Plant origin Astragalus membranaceus (Fisch.) Bge.. Used part: Root Extracting solvent Edible alcohol: water=70:30 Storage Condition Preserve in tight containers in dry and cool ... more
    Brand Name:COGON
    Model Number:25%
    Place of Origin:Chengdu, P. R.China

    25% Astragaloside IV , Health Care Astragalus Iv CAS Number 84687-43-4

  • Quality 98% Cordycepin, Cordycepin powder,Cordyceps Extract CAS number:  73-03-0 wholesale
    ...deoxyadenosine/Cdycepin/Cordyceps Sinensis Extract 98% Cordycepin, Cordycepin powder,Cordyceps Extract CAS number: 73-03-0 Cordycepin Chemical name: 3-deoxyadenosine CAS number: 73-03-0 Product purity: ≥98% Color: white powder Molecular Formula: ... more
    Brand Name:Avec
    Model Number:98% Cordycepin
    Place of Origin:China

    98% Cordycepin, Cordycepin powder,Cordyceps Extract CAS number: 73-03-0

  • Quality CAS Number 3458-28-4 D Mannose With 99% Purity For Foods Supplements wholesale
    CAS Number 3458-28-4 D Mannose with 99% Purity for Foods Supplements Mannose is an organic compound with a molecular formula of C6H12O6 and a molecular weight of 180.156. It is a colorless or white crystalline powder. It is a carbohydrate that plays an important role in the process of human metabolism, especially in the glycosylation of specific proteins. Quick Details of D-Mannose Product Name D-Mannose Country of Origin China CAS Number... more
    Brand Name:BBP
    Model Number:BBP-MANNOSE-01
    Place of Origin:CHINA

    CAS Number 3458-28-4 D Mannose With 99% Purity For Foods Supplements

    Beyond Bioherbal Co.,ltd.
    [Shanghai,China]
  • Quality Raspberry ketone CAS No.: 84929-76-0 wholesale
    Raspberry ketone CAS No.: 84929-76-0 Appearance: white powder Variety: raspberry extract Extract Method: Water/ Grain Alcohol Specification:99% ABOUT Raspberry Ketones: ... more
    Brand Name:Chinafoodpharm
    Place of Origin:China
    Certification:GMP,ISO,HACCP

    Raspberry ketone CAS No.: 84929-76-0

  • Quality Arbutin;CAS NO.: 497-76-7;98% wholesale
    English name]: Arbutin [CAS NO.]: 497-76-7 [Formula]: C12H16O7 [Molecular Weight]: 272.25 [Structural Formula]: [Specification]: 98% [Test method]: HPLC [Product properties]: ... more
    Brand Name:Zhanjo
    Model Number:ZJ-257
    Place of Origin:China

    Arbutin;CAS NO.: 497-76-7;98%

  • Quality (CAS No.:82161-76-0)INDENYLZIRCONIUM(IV) TRICHLORIDE wholesale
    INDENYLZIRCONIUM(IV) TRICHLORIDE Product code:INDENYLZIRCONIUM(IV) TRICHLORIDE CAS No.:82161-76-0 Molecular formula: C9H7Cl3Zr Molecular Weight: 312.73 Materialized properties: Melting Point: 151-161°c In Stock : Available / Available on request Supply ... more
    Brand Name:Honorshine Chem
    Place of Origin:China WuXi
    Minimum Order Quantity:2KG

    (CAS No.:82161-76-0)INDENYLZIRCONIUM(IV) TRICHLORIDE

  • Quality Olopatadine hydrochloride,Olopatadine( CAS NO.:140462-76-6) wholesale
    Name :Olopatadine hydrochloride Synonyms :(Z)-11-[3-(Dimethylamino)propylidene]-6,11-dihydrodibenz[b,e]oxepin-2-acetic acid hydrochloride Molecular Formula : C21H23NO3.HCl Molecular Weight :373.88 CAS NO.: 140462-76-6 more
    Brand Name:Olopatadine hydrochloride
    Model Number:CAS NO.:140462-76-6
    Place of Origin:.

    Olopatadine hydrochloride,Olopatadine( CAS NO.:140462-76-6)

  • Quality Exenatide Acetate Cas No:141732-76-5 wholesale
    Product Information Name:Exenatide Acetate, Exenatida Cas No:141732-76-5 Formula: C186H286N50O62S Molecular:4246.62 Sequence: HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS Purity:98% Appearance: white powder Source: synthetic Also know as AC 2993, Bydureon, ... more
    Brand Name:YS
    Model Number:YSCP
    Place of Origin:China

    Exenatide Acetate Cas No:141732-76-5

  • Quality CAS Number 87-99-0 Food Grade Sweetener Bulk Xilitol Powder wholesale
    Wholesale Food Grade Sweetener Bulk Xilitol Powder What’s the Xilitol Powder? Xylitol is a kind of sugar alcohol compound with the formula C5H12O5. It is a colorless or white crystalline solid that is soluble in water. Xylitol naturally exists in small amo... more
    Brand Name:Ceres
    Model Number:GMP standard Xilitol Powder
    Place of Origin:Shaanxi, China

    CAS Number 87-99-0 Food Grade Sweetener Bulk Xilitol Powder

  • Quality 20kg/Bag Dtf Hot Melt Powder Cas Number 9009 54 5 For Textile wholesale
    20kg/Bag Hot Melt Adhesive Polyurethane Tpu Powder For Textile TPU Powder Description This product is thermoplastic polyurethane powder hot melt adhesive. The product has a soft feel, good resilience, stretchability, and excellent low-temperature ... more
    Brand Name:Esun
    Model Number:ES220
    Place of Origin:China

    20kg/Bag Dtf Hot Melt Powder Cas Number 9009 54 5 For Textile

  • Quality 65% purity Calcium Hypochlorite (Calcium process) CAS number 7778-54-3 wholesale
    ...: Ca(clo)2 Appearance: white or slight gray granular, powder, tablet Usage: For bleaching purpose of wood pulp, silk, cloth and ... more
    Brand Name:Twin
    Model Number:TW-Calcium Hypochlorite
    Place of Origin:China

    65% purity Calcium Hypochlorite (Calcium process) CAS number 7778-54-3

  • Quality 100% natural Panax Ginseng Extract Ginsenosides 20% -80% UV,CAS Number :41753-43-9 wholesale
    Panax Ginseng Extract Ginsenosides 20% -80% UV,CAS Number :41753-43-9 Description: Product Name: Panax Ginseng Extract CAS NO.: 90045-38-8 Part Used: Root or leaf Appearance: Light Yellow Powder Specification: 80% Ginsenosides Test Method: UV Active ... more
    Brand Name:Greenspring
    Model Number:098
    Place of Origin:Heilongjiang province

    100% natural Panax Ginseng Extract Ginsenosides 20% -80% UV,CAS Number :41753-43-9

Tell “cas number 111 76 2” Suppliers Your Requirement
*E-mail:
* Message:
Characters Remaining: (0/3000)
Inquiry Cart 0